CA194_HUMAN   Q5T5A4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5T5A4

Recommended name:Protein C1orf194

EC number:

Alternative names:

Cleaved into:

GeneID:127003

Gene names  (primary ):C1orf194

Gene names  (synonym ):

Gene names  (ORF ):

Length:169

Mass:19350

Sequence:MPPTRDPFQQPTLDNDDSYLGELRASKKLPYKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNHHTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPITFLANIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKKDGGFFST

Tissue specificity:Expressed in cerebrum, cerebellum, gastrocnemius muscle, spinal cord and lung tissues. {ECO:0000269|PubMed:31199454}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp