F241B_HUMAN Q96D05
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96D05
Recommended name：Protein FAM241B
EC number：
Alternative names：
Cleaved into：
GeneID：219738
Gene names (primary )：FAM241B
Gene names (synonym )：C10orf35
Gene names (ORF )：
Length：121
Mass：13238
Sequence：MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQLVNMGFPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQR
Tissue specificity：
Induction：
Developmental stage：
Protein families：FAM241 family