F209B_HUMAN   Q5JX69


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5JX69

Recommended name:Protein FAM209B

EC number:

Alternative names:

Cleaved into:

GeneID:388799

Gene names  (primary ):FAM209B

Gene names  (synonym ):C20orf107

Gene names  (ORF ):

Length:171

Mass:19499

Sequence:MWTLKSSLVLLLCLTCSYAFMFSSLRQKTSEPQGKVPCGEHFRIRQNLPEHTQGWLGSKWLWLLFAVVPFVILQCQRDSEKNKEQSPPGLRGFPFRTPLKKNQNASLYKDCVFNTLNELEVELLKFVSEVQNLKGAMATGSGSNLKLRRSEMPADPYHVTICKIWGEESSS

Tissue specificity:

Induction:

Developmental stage:

Protein families:FAM209 family


   💬 WhatsApp