CSMT1_HUMAN   Q4G0I0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4G0I0

Recommended name:Protein CCSMST1

EC number:

Alternative names:

Cleaved into:

GeneID:283951

Gene names  (primary ):CCSMST1

Gene names  (synonym ):C16orf91

Gene names  (ORF ):

Length:132

Mass:15004

Sequence:MNRVLCAPAAGAVRALRLIGWASRSLHPLPGSRDRAHPAAEEEDDPDRPIEFSSSKANPHRWSVGHTMGKGHQRPWWKVLPLSCFLVALIIWCYLREESEADQWLRQVWGEVPEPSDRSEEPETPAAYRART

Tissue specificity:

Induction:

Developmental stage:

Protein families:CCSMST1 family


   💬 WhatsApp