CH037_HUMAN   Q96NL8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96NL8

Recommended name:Protein C8orf37

EC number:

Alternative names:

Cleaved into:

GeneID:157657

Gene names  (primary ):C8orf37

Gene names  (synonym ):smalltalk

Gene names  (ORF ):

Length:207

Mass:23381

Sequence:MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINEILEEPNLDKKPSKLKSKSSGNTSVRASIEGLGKSCSPVYLGGSSIPCGIGTNISWRACDHLRCIACDFLVVSYDDYMWDKSCDYLFFRNNMPEFHKLKAKLIKKKGTRAYACQCSWRTIEEVTDLQTDHQLRWVCGKH

Tissue specificity:Widely expressed, with highest levels in heart and brain. Also expressed in the retina (at protein level). {ECO:0000269|PubMed:22177090}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp