AF1Q_HUMAN   Q13015


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q13015

Recommended name:Protein AF1q

EC number:

Alternative names:

Cleaved into:

GeneID:10962

Gene names  (primary ):MLLT11

Gene names  (synonym ):AF1Q

Gene names  (ORF ):

Length:90

Mass:10061

Sequence:MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL

Tissue specificity:Expressed in myoepithelial cells of normal breast tissue (at protein level) (PubMed:26079538). Highly expressed in thymus (PubMed:7833468). Expressed in colon, small intestine, prostate and ovary. Not detected in peripheral blood lymphocytes and spleen (PubMed:7833468). {ECO:0000269|PubMed:26079538, ECO:0000269|PubMed:7833468}.

Induction:

Developmental stage:

Protein families:MLLT11 family


   💬 WhatsApp