AKIR1_HUMAN   Q9H9L7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H9L7

Recommended name:Akirin-1

EC number:

Alternative names:

Cleaved into:

GeneID:79647

Gene names  (primary ):AKIRIN1

Gene names  (synonym ):C1orf108

Gene names  (ORF ):

Length:192

Mass:21867

Sequence:MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPPFQTQTPPQSLQQPAPPGSERRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFTLRQVGIICERLLKDYEDKIREEYEQILNTKLAEQYESFVKFTHDQIMRRYGTRPTSYVS

Tissue specificity:Widely expressed with the highest expression in heart, liver, placenta and peripheral blood leukocytes. {ECO:0000269|PubMed:18066067}.

Induction:

Developmental stage:

Protein families:Akirin family


   💬 WhatsApp