LYG2_HUMAN   Q86SG7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86SG7

Recommended name:Lysozyme g-like protein 2

EC number:EC:3.2.1.-

Alternative names:

Cleaved into:

GeneID:254773

Gene names  (primary ):LYG2

Gene names  (synonym ):LYGH

Gene names  (ORF ):

Length:212

Mass:23498

Sequence:MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSF

Tissue specificity:Strong expression detected in the eye and weak expression in the testis. No expression is observed in any other tissues. {ECO:0000269|PubMed:21093056}.

Induction:

Developmental stage:

Protein families:Glycosyl hydrolase 23 family


   💬 WhatsApp