ANFC_HUMAN   P23582


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P23582

Recommended name:C-type natriuretic peptide

EC number:

Alternative names:

Cleaved into:CNP-22; CNP-29; CNP-53

GeneID:4880

Gene names  (primary ):NPPC

Gene names  (synonym ):CNP2

Gene names  (ORF ):

Length:126

Mass:13246

Sequence:MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC

Tissue specificity:[CNP-22]: In the kidney, predominantly expressed in the distal tubular cells (at protein level). {ECO:0000269|PubMed:9794555}.

Induction:

Developmental stage:

Protein families:Natriuretic peptide family


   💬 WhatsApp