REL1_HUMAN   P04808


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P04808

Recommended name:Prorelaxin H1

EC number:

Alternative names:

Cleaved into:Relaxin B chain; Relaxin A chain

GeneID:6013

Gene names  (primary ):RLN1

Gene names  (synonym ):

Gene names  (ORF ):

Length:185

Mass:21146

Sequence:MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC

Tissue specificity:Prostate. Not expressed in placenta, decidua or ovary. {ECO:0000269|PubMed:8735594}.

Induction:

Developmental stage:

Protein families:Insulin family


   💬 WhatsApp