ZNT2_HUMAN   Q9BRI3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BRI3

Recommended name:Zinc transporter 2

EC number:

Alternative names:(ZnT-2) (Solute carrier family 30 member 2)

Cleaved into:

GeneID:7780

Gene names  (primary ):SLC30A2

Gene names  (synonym ):ZNT2

Gene names  (ORF ):

Length:323

Mass:35178

Sequence:MEAKEKQHLLDARPAIRSYTGSLWQEGAGWIPLPRPGLDLQAIELAAQSNHHCHAQKGPDSHCDPKKGKAQRQLYVASAICLLFMIGEVVEILGALVSVLSIWVVTGVLVYLAVERLISGDYEIDGGTMLITSGCAVAVNIIMGLTLHQSGHGHSHGTTNQQEENPSVRAAFIHVIGDFMQSMGVLVAAYILYFKPEYKYVDPICTFVFSILVLGTTLTILRDVILVLMEGTPKGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD

Tissue specificity:

Induction:

Developmental stage:

Protein families:Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily


   💬 WhatsApp