ZN396_HUMAN Q96N95
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96N95
Recommended name：Zinc finger protein 396
EC number：
Alternative names：(Zinc finger and SCAN domain-containing protein 14)
Cleaved into：
GeneID：252884
Gene names (primary )：ZNF396
Gene names (synonym )：ZSCAN14
Gene names (ORF )：
Length：335
Mass：38612
Sequence：MSAKLGKSSSLLTQTSEECNGILTEKMEEEEQTCDPDSSLHWSSSYSPETFRQQFRQFGYQDSPGPHEALSRLWELCHLWLRPEVHTKEQILELLVLEQFLAILPKELQAWVQKHHPENGEETVTMLEDVERELDGPKQIFFGRRKDMIAEKLAPSEITEELPSSQLMPVKKQLQGASWELQSLRPHDEDIKTTNVKSASRQKTSLGIELHCNVSNILHMNGSQSSTYRGTYEQDGRFEKRQGNPSWKKQQKCDECGKIFSQSSALILHQRIHSGKKPYACDECAKAFSRSAILIQHRRTHTGEKPYKCHDCGKAFSQSSNLFRHRKRHIRKKVP
Tissue specificity：Expressed strongly in liver, moderately in skeletal muscle and weakly in kidney, pancreas, spleen and prostate. {ECO:0000269|PubMed:12801647}.
Induction：
Developmental stage：
Protein families：Krueppel C2H2-type zinc-finger protein family