ZHX1R_HUMAN   Q96EF9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96EF9

Recommended name:Zinc fingers and homeoboxes protein 1, isoform 2

EC number:

Alternative names:(ZHX1-C8orf76 readthrough transcript protein)

Cleaved into:

GeneID:100533106

Gene names  (primary ):ZHX1-C8orf76

Gene names  (synonym ):C8orf76

Gene names  (ORF ):

Length:292

Mass:33285

Sequence:MLRKLWQWFYEETESSDDVEVLTLKKFKGDLAYRRQEYQKALQEYSSISEKLSSTNFAMKRDVQEGQARCLAHLGRHMEALEIAANLENKATNTDHLTTVLYLQLAICSSLQNLEKTIFCLQKLISLHPFNPWNWGKLAEAYLNLGPALSAALASSQKQHSFTSSDKTIKSFFPHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRETVLIETQLKACASFIRTRLLLQFTQPQQTSFALERNLRTQQEIEDKMKGFSFKEDTLLLIAEVSVSLGFM

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp