COPZ1_HUMAN   P61923


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P61923

Recommended name:Coatomer subunit zeta-1

EC number:

Alternative names:(Zeta-1-coat protein) (Zeta-1 COP)

Cleaved into:

GeneID:22818

Gene names  (primary ):COPZ1

Gene names  (synonym ):COPZ

Gene names  (ORF ):CGI-120 HSPC181

Length:177

Mass:20198

Sequence:MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Adaptor complexes small subunit family


   💬 WhatsApp