RAB1A_HUMAN   P62820


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P62820

Recommended name:Ras-related protein Rab-1A

EC number:

Alternative names:(YPT1-related protein)

Cleaved into:

GeneID:5861

Gene names  (primary ):RAB1A

Gene names  (synonym ):RAB1

Gene names  (ORF ):

Length:205

Mass:22678

Sequence:MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC

Tissue specificity:

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Rab family


   💬 WhatsApp