WHAL1_HUMAN Q1A5X7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q1A5X7
Recommended name：Putative WASP homolog-associated protein with actin, membranes and microtubules-like protein 1
EC number：
Alternative names：(WAS protein homolog associated with actin, Golgi membranes and microtubules pseudogene 3) (WAS protein homology region 2 domain-containing protein 1-like protein 1) (WH2 domain-containing protein 1-like protein 1) (WHDC1-like protein 1)
Cleaved into：
GeneID：
Gene names (primary )：WHAMMP3
Gene names (synonym )：WHAMML1 WHDC1L1
Gene names (ORF )：
Length：153
Mass：18091
Sequence：MMILVFWSNYPYEPVCLASHRNNMEASVPKYKKHLPQLGMQKEMEQDVKRFGQAAWATAIPRLEKLKLMLAQETLQLMRAKELCLNHKRAEIQGKMEDLPEQEKNINVVDELAIQFYEIQLELYEVKFEILKNKEILLTTQLDSLERLIKDEI
Tissue specificity：
Induction：
Developmental stage：
Protein families：