SMIM1_HUMAN   B2RUZ4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B2RUZ4

Recommended name:Small integral membrane protein 1

EC number:

Alternative names:(Vel blood group antigen)

Cleaved into:

GeneID:388588

Gene names  (primary ):SMIM1

Gene names  (synonym ):

Gene names  (ORF ):

Length:78

Mass:8749

Sequence:MQPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKLGIAMKVLGGVALFWIIFILGYLTGYYVHKCK

Tissue specificity:Highly expressed in the bone marrow and expressed at lower levels in non-hematopoietic tissues. Highly expressed in erythroleukemia cell lines. Up-regulated in CD34+ hematopoietic progenitors cultured toward red blood cells. {ECO:0000269|PubMed:23563606}.

Induction:

Developmental stage:

Protein families:SMIM1 family


   💬 WhatsApp