VDAC2_HUMAN P45880
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P45880
Recommended name：Voltage-dependent anion-selective channel protein 2
EC number：
Alternative names：(VDAC-2) (hVDAC2) (Outer mitochondrial membrane protein porin 2)
Cleaved into：
GeneID：7417
Gene names (primary )：VDAC2
Gene names (synonym )：
Gene names (ORF )：
Length：294
Mass：31567
Sequence：MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
Tissue specificity：Expressed in erythrocytes (at protein level) (PubMed:27641616). Expressed in all tissues examined (PubMed:8420959). {ECO:0000269|PubMed:27641616, ECO:0000269|PubMed:8420959}.
Induction：
Developmental stage：
Protein families：Eukaryotic mitochondrial porin family