VATG3_HUMAN   Q96LB4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96LB4

Recommended name:V-type proton ATPase subunit G 3

EC number:

Alternative names:(V-ATPase subunit G 3) (V-ATPase 13 kDa subunit 3) (Vacuolar proton pump subunit G 3)

Cleaved into:

GeneID:127124

Gene names  (primary ):ATP6V1G3

Gene names  (synonym ):ATP6G3

Gene names  (ORF ):

Length:118

Mass:13917

Sequence:MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN

Tissue specificity:Kidney. {ECO:0000269|PubMed:12384298}.

Induction:

Developmental stage:

Protein families:V-ATPase G subunit family


   💬 WhatsApp