VCX1_HUMAN   Q9H320


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H320

Recommended name:Variable charge X-linked protein 1

EC number:

Alternative names:(Variable charge protein on X with ten repeats) (VCX-10r) (Variably charged protein X-B1) (VCX-B1)

Cleaved into:

GeneID:26609

Gene names  (primary ):VCX

Gene names  (synonym ):VCX1 VCX10R VCXB1

Gene names  (ORF ):

Length:206

Mass:22289

Sequence:MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESAPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQEAELEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEEPLSQESQVEEPPSQESEMEELPSV

Tissue specificity:Expressed exclusively in testis.

Induction:

Developmental stage:

Protein families:VCX/VCY family


   💬 WhatsApp