VAMP2_HUMAN   P63027


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63027

Recommended name:Vesicle-associated membrane protein 2

EC number:

Alternative names:(VAMP-2) (Synaptobrevin-2)

Cleaved into:

GeneID:6844

Gene names  (primary ):VAMP2

Gene names  (synonym ):SYB2

Gene names  (ORF ):

Length:116

Mass:12663

Sequence:MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Tissue specificity:Nervous system and skeletal muscle. {ECO:0000269|PubMed:8760387}.

Induction:

Developmental stage:

Protein families:Synaptobrevin family


   💬 WhatsApp