VAMP1_HUMAN   P23763


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P23763

Recommended name:Vesicle-associated membrane protein 1

EC number:

Alternative names:(VAMP-1) (Synaptobrevin-1)

Cleaved into:

GeneID:6843

Gene names  (primary ):VAMP1

Gene names  (synonym ):SYB1

Gene names  (ORF ):

Length:118

Mass:12902

Sequence:MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT

Tissue specificity:Nervous system, skeletal muscle and adipose tissue.

Induction:

Developmental stage:

Protein families:Synaptobrevin family


   💬 WhatsApp