CLRN1_HUMAN   P58418


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P58418

Recommended name:Clarin-1

EC number:

Alternative names:(Usher syndrome type-3 protein)

Cleaved into:

GeneID:7401

Gene names  (primary ):CLRN1

Gene names  (synonym ):USH3A

Gene names  (ORF ):

Length:232

Mass:25719

Sequence:MPSQQKKIIFCMAGVFSFACALGVVTALGTPLWIKATVLCKTGALLVNASGQELDKFMGEMQYGLFHGEGVRQCGLGARPFRFSFFPDLLKAIPVSIHVNVILFSAILIVLTMVGTAFFMYNAFGKPFETLHGPLGLYLLSFISGSCGCLVMILFASEVKIHHLSEKIANYKEGTYVYKTQSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMY

Tissue specificity:Widely expressed. Found in the retina.

Induction:

Developmental stage:

Protein families:Clarin family


   💬 WhatsApp