UCP3_HUMAN P55916
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P55916
Recommended name：Mitochondrial uncoupling protein 3
EC number：
Alternative names：(UCP 3) (Solute carrier family 25 member 9)
Cleaved into：
GeneID：7352
Gene names (primary )：UCP3
Gene names (synonym )：SLC25A9
Gene names (ORF )：
Length：312
Mass：34216
Sequence：MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRALMKVQMLRESPF
Tissue specificity：Only in skeletal muscle and heart. Is more expressed in glycolytic than in oxidative skeletal muscles. {ECO:0000269|PubMed:9196039}.
Induction：
Developmental stage：
Protein families：Mitochondrial carrier (TC 2.A.29) family