UCMA_HUMAN Q8WVF2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8WVF2
Recommended name：Unique cartilage matrix-associated protein [Cleaved into: Unique cartilage matrix-associated protein C-terminal fragment
EC number：
Alternative names：(Ucma-C) (Gla-rich protein) (GRP)]
Cleaved into：Unique cartilage matrix-associated protein C-terminal fragment (Ucma-C) (Gla-rich protein) (GRP)
GeneID：221044
Gene names (primary )：UCMA
Gene names (synonym )：C10orf49
Gene names (ORF )：
Length：138
Mass：16563
Sequence：MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
Tissue specificity：Predominantly expressed in resting chondrocytes. {ECO:0000269|PubMed:16176871}.
Induction：
Developmental stage：
Protein families：UCMA family