UCK2_HUMAN Q9BZX2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BZX2
Recommended name:Uridine-cytidine kinase 2
EC number:EC:2.7.1.48
Alternative names:(UCK 2) (Cytidine monophosphokinase 2) (Testis-specific protein TSA903) (Uridine monophosphokinase 2)
Cleaved into:
GeneID:7371
Gene names (primary ):UCK2
Gene names (synonym ):UMPK
Gene names (ORF ):
Length:261
Mass:29299
Sequence:MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH
Tissue specificity:According to PubMed:8812458; testis-specific. According to PubMed:11306702, placenta-specific. {ECO:0000269|PubMed:8812458}.
Induction:
Developmental stage:
Protein families:Uridine kinase family