UCHL5_HUMAN   Q9Y5K5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y5K5

Recommended name:Ubiquitin carboxyl-terminal hydrolase isozyme L5

EC number:EC:3.4.19.12

Alternative names:(UCH-L5) (Ubiquitin C-terminal hydrolase UCH37) (Ubiquitin thioesterase L5)

Cleaved into:

GeneID:51377

Gene names  (primary ):UCHL5

Gene names  (synonym ):UCH37

Gene names  (ORF ):AD-019 CGI-70

Length:329

Mass:37607

Sequence:MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Peptidase C12 family


   💬 WhatsApp