U1SBP_HUMAN Q16560
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16560
Recommended name：U11/U12 small nuclear ribonucleoprotein 35 kDa protein
EC number：
Alternative names：(U11/U12 snRNP 35 kDa protein) (U11/U12-35K) (Protein HM-1) (U1 snRNP-binding protein homolog)
Cleaved into：
GeneID：11066
Gene names (primary )：SNRNP35
Gene names (synonym )：HM1 U1SNRNPBP
Gene names (ORF )：
Length：246
Mass：29450
Sequence：MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERSRSRERHWDSRTRDRDHDRGREKRWQEREPTRVWPDNDWERERDFRDDRIKGREKKERGK
Tissue specificity：Expressed in heart, liver, skeletal muscle and pancreas. {ECO:0000269|PubMed:10520751}.
Induction：
Developmental stage：
Protein families：