TSAS2_HUMAN   P59090


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P59090

Recommended name:Putative uncharacterized protein TSPEAR-AS2

EC number:

Alternative names:(TSPEAR antisense RNA 2) (TSPEAR antisense gene protein 2)

Cleaved into:

GeneID:

Gene names  (primary ):TSPEAR-AS2

Gene names  (synonym ):C21orf90

Gene names  (ORF ):

Length:65

Mass:7097

Sequence:MGNPRLPRLLCALKFSGFLSNIRGPLAGEDGMGDTQLARVRDSALKTPWRPAPCPPPAHSLDDWK

Tissue specificity:Widely expressed. Not expressed in liver and muscle. {ECO:0000269|PubMed:12036297}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp