TSN4_HUMAN O14817
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O14817
Recommended name：Tetraspanin-4
EC number：
Alternative names：(Tspan-4) (Novel antigen 2) (NAG-2) (Transmembrane 4 superfamily member 7)
Cleaved into：
GeneID：7106
Gene names (primary )：TSPAN4
Gene names (synonym )：NAG2 TM4SF7
Gene names (ORF )：
Length：238
Mass：26118
Sequence：MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIITGAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTFAMTMYCQVVKADTYCA
Tissue specificity：Expressed in multiple tissues but is absent in brain, lymphoid cells, and platelets.
Induction：
Developmental stage：
Protein families：Tetraspanin (TM4SF) family