TSN33_HUMAN   Q86UF1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86UF1

Recommended name:Tetraspanin-33

EC number:

Alternative names:(Tspan-33) (Penumbra) (hPen) (Proerythroblast new membrane)

Cleaved into:

GeneID:340348

Gene names  (primary ):TSPAN33

Gene names  (synonym ):PEN

Gene names  (ORF ):

Length:283

Mass:31538

Sequence:MARRPRAPAASGEEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACLAVDPAILLIVVGVLMFLLTFCGCIGSLRENICLLQTFSLCLTAVFLLQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRADPWY

Tissue specificity:Predominantly expressed in erythroblasts. {ECO:0000269|PubMed:17158226}.

Induction:

Developmental stage:

Protein families:Tetraspanin (TM4SF) family


   💬 WhatsApp