TSN13_HUMAN O95857
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95857
Recommended name：Tetraspanin-13
EC number：
Alternative names：(Tspan-13) (Tetraspan NET-6) (Transmembrane 4 superfamily member 13)
Cleaved into：
GeneID：27075
Gene names (primary )：TSPAN13
Gene names (synonym )：NET6 TM4SF13
Gene names (ORF )：UNQ260/PRO296
Length：204
Mass：22147
Sequence：MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL
Tissue specificity：
Induction：
Developmental stage：
Protein families：Tetraspanin (TM4SF) family