TRIB2_HUMAN   Q92519


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q92519

Recommended name:Tribbles homolog 2

EC number:

Alternative names:(TRB-2)

Cleaved into:

GeneID:28951

Gene names  (primary ):TRIB2

Gene names  (synonym ):TRB2

Gene names  (ORF ):

Length:343

Mass:38801

Sequence:MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN

Tissue specificity:Highly expressed in peripheral blood leukocytes. {ECO:0000269|PubMed:15299019}.

Induction:

Developmental stage:

Protein families:Protein kinase superfamily, CAMK Ser/Thr protein kinase family, Tribbles subfamily


   💬 WhatsApp