TPC6B_HUMAN Q86SZ2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q86SZ2
Recommended name：Trafficking protein particle complex subunit 6B
EC number：
Alternative names：(TRAPP complex subunit 6B)
Cleaved into：
GeneID：122553
Gene names (primary )：TRAPPC6B
Gene names (synonym )：
Gene names (ORF )：
Length：158
Mass：17983
Sequence：MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAGKQYLEHASKYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMIQKL
Tissue specificity：Both isoforms are expressed ubiquitously (at transcript level), isoform 1 being the most predominant (PubMed:28626029). Expressed in the fetal brain and different regions of the adult brain and spinal cord (PubMed:28626029). {ECO:0000269|PubMed:28626029}.
Induction：
Developmental stage：
Protein families：TRAPP small subunits family, BET3 subfamily