TAF13_HUMAN Q15543
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q15543
Recommended name:Transcription initiation factor TFIID subunit 13
EC number:
Alternative names:(Transcription initiation factor TFIID 18 kDa subunit) (TAF(II)18) (TAFII-18) (TAFII18)
Cleaved into:
GeneID:6884
Gene names (primary ):TAF13
Gene names (synonym ):TAF2K TAFII18
Gene names (ORF ):
Length:124
Mass:14287
Sequence:MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS
Tissue specificity:
Induction:
Developmental stage:
Protein families:TAF13 family