NR2CA_HUMAN   Q86WQ0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86WQ0

Recommended name:Nuclear receptor 2C2-associated protein

EC number:

Alternative names:(TR4 orphan receptor-associated 16 kDa protein)

Cleaved into:

GeneID:126382

Gene names  (primary ):NR2C2AP

Gene names  (synonym ):TRA16

Gene names  (ORF ):

Length:139

Mass:15876

Sequence:MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV

Tissue specificity:Expressed in all tissues examined, with highest expression in heart, skeletal muscle and pancreas. {ECO:0000269|PubMed:12486131}.

Induction:

Developmental stage:

Protein families:NR2C2AP family


   💬 WhatsApp