TOR2A_HUMAN   Q5JU69


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5JU69

Recommended name:Torsin-2A

EC number:

Alternative names:(Torsin family 2 member A) (Torsin-related protein 1)

Cleaved into:

GeneID:27433

Gene names  (primary ):TOR2A

Gene names  (synonym ):TORP1

Gene names  (ORF ):UNQ6408/PRO21181

Length:321

Mass:35714

Sequence:MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECDFRPDLPGLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKSYVSSLLAHYLFQGGLRSPRVHHFSPVLHFPHPSHIERYKKDLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGSSWVVYGTNYRKAIFIFISNTGGKQINQVALEAWRSRRDREEILLQELEPVISRAVLDNPHHGFSNSGIMEERLLDAVVPFLPLQRHHVRHCVLNELAQLGLEPRDEVVQAVLDSTTFFPEDEQLFSSNGCKTVASRIAFFL

Tissue specificity:Isoform 1 is expressed ubiquitously, except in cardiac and endothelial tissues. {ECO:0000269|PubMed:12910263}.

Induction:

Developmental stage:

Protein families:ClpA/ClpB family, Torsin subfamily


   💬 WhatsApp