TOR2X_HUMAN   Q8N2E6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N2E6

Recommended name:Prosalusin

EC number:

Alternative names:(Torsin family 2 member A) (Torsin-2A)

Cleaved into:Salusin-alpha; Salusin-beta

GeneID:27433

Gene names  (primary ):TOR2A

Gene names  (synonym ):

Gene names  (ORF ):HEMBA1005096 PSEC0218

Length:242

Mass:26262

Sequence:MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECDFRPDLPGLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKSYVSSLLAHYLFQGGLRSPRVHHFSPVLHFPHPSHIERYKKDLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGSSWVVYGTNYRKAIFIFIRWLLKLGHHGRAPPRRSGALPPAPAAPRPALRAQRAGPAGPGAKG

Tissue specificity:Isoform 4 is ubiquitously expressed, with high level in vascular endothelial cells and vascular smooth muscle cells. {ECO:0000269|PubMed:12910263}.

Induction:

Developmental stage:

Protein families:ClpA/ClpB family, Torsin subfamily


   💬 WhatsApp