TIMP4_HUMAN   Q99727


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99727

Recommended name:Metalloproteinase inhibitor 4

EC number:

Alternative names:(Tissue inhibitor of metalloproteinases 4) (TIMP-4)

Cleaved into:

GeneID:7079

Gene names  (primary ):TIMP4

Gene names  (synonym ):

Gene names  (ORF ):

Length:224

Mass:25503

Sequence:MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP

Tissue specificity:Abundant in heart and present at low levels in many other tissues.

Induction:

Developmental stage:

Protein families:Protease inhibitor I35 (TIMP) family


   💬 WhatsApp