TIP39_HUMAN Q96A98
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96A98
Recommended name：Tuberoinfundibular peptide of 39 residues
EC number：
Alternative names：(TIP39) (Parathyroid hormone 2)
Cleaved into：
GeneID：113091
Gene names (primary )：PTH2
Gene names (synonym )：TIP39 TIPF39
Gene names (ORF )：
Length：100
Mass：11202
Sequence：METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Tissue specificity：Highly expressed in fetal and adult brain, cerebellum and trachea. Weakly expressed in spinal cord, fetal liver, kidney and heart. {ECO:0000269|PubMed:12098667}.
Induction：
Developmental stage：
Protein families：Parathyroid hormone family