TR3N_HUMAN   Q6F5E7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6F5E7

Recommended name:Protein TXNRD3NB

EC number:

Alternative names:(Thioredoxin reductase 2 intronic transcript 1) (Thioredoxin reductase 3 intronic transcript 1) (Thioredoxin reductase 3 neighbor gene protein) (TXNRD3 neighbor gene protein) (Thioredoxin reductase 3 new transcript 1)

Cleaved into:

GeneID:

Gene names  (primary ):TXNRD3NB

Gene names  (synonym ):TR2IT1 TXNRD3IT1 TXNRD3NT1

Gene names  (ORF ):

Length:133

Mass:14331

Sequence:MRDLSERRLGQPELKAEQQMPLEPVRARLSVGLACCCSHTTAEASSLEHGDKVFGQGFPSPLEEIKRLLKISRALQARSVPSTQEKAKCLSGEPGQPEGKGQETYPGPGKVEGKAEPAMRKDDVCPGMKCISG

Tissue specificity:Expressed in pancreas, esophagus, bone marrow and keratinocytes. {ECO:0000269|PubMed:15674732}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp