TMX1_HUMAN   Q9H3N1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H3N1

Recommended name:Thioredoxin-related transmembrane protein 1

EC number:

Alternative names:(Thioredoxin domain-containing protein 1) (Transmembrane Trx-related protein)

Cleaved into:

GeneID:81542

Gene names  (primary ):TMX1

Gene names  (synonym ):TMX TXNDC TXNDC1

Gene names  (ORF ):PSEC0085 UNQ235/PRO268

Length:280

Mass:31791

Sequence:MAPSGSLAVPLAVLVLLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLGLCMIFVADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS

Tissue specificity:Ubiquitous. Highly expressed in kidney, liver, placenta and lung.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp