TF2LY_HUMAN   Q8IUE0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8IUE0

Recommended name:Homeobox protein TGIF2LY

EC number:

Alternative names:(TGF-beta-induced transcription factor 2-like protein) (TGFB-induced factor 2-like protein, Y-linked) (TGIF-like on the Y)

Cleaved into:

GeneID:90655

Gene names  (primary ):TGIF2LY

Gene names  (synonym ):TGIFLY

Gene names  (ORF ):

Length:185

Mass:20814

Sequence:MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPVVQTMYKACPCGPCQRARCQERSNQIRSRPLARSSPE

Tissue specificity:Specifically expressed in adult testis.

Induction:

Developmental stage:

Protein families:TALE/TGIF homeobox family


   💬 WhatsApp