TF2LX_HUMAN   Q8IUE1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8IUE1

Recommended name:Homeobox protein TGIF2LX

EC number:

Alternative names:(TGF-beta-induced transcription factor 2-like protein) (TGFB-induced factor 2-like protein, X-linked) (TGIF-like on the X)

Cleaved into:

GeneID:90316

Gene names  (primary ):TGIF2LX

Gene names  (synonym ):TGIFLX

Gene names  (ORF ):

Length:241

Mass:26675

Sequence:MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPNP

Tissue specificity:Specifically expressed in adult testis.

Induction:

Developmental stage:

Protein families:TALE/TGIF homeobox family


   💬 WhatsApp