PRY_HUMAN   O14603


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O14603

Recommended name:PTPN13-like protein, Y-linked

EC number:

Alternative names:(Testis-specific PTP-BL-related Y protein)

Cleaved into:

GeneID:442862

Gene names  (primary ):PRY; PRY2; PRYP3; PRYP4

Gene names  (synonym ):PRY1 PTPN13LY; PTPN13LY2; ;

Gene names  (ORF ):; ; ;

Length:147

Mass:16512

Sequence:MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLWRYGKVGCISLPLREMTAWINPPQISEIFQGYHQRVHGADALSLQTNSLRSRLSSQCLGQSFLLRTLERGRGFRALGDICGHVHEED

Tissue specificity:Expressed in testis. Detected in spermatocytes, spermatids and spermatozoa (at protein level). {ECO:0000269|PubMed:11420382, ECO:0000269|PubMed:14665702}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp