SPAT4_HUMAN   Q8NEY3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NEY3

Recommended name:Spermatogenesis-associated protein 4

EC number:

Alternative names:(Testis and spermatogenesis cell-related protein 2) (Testis spermatocyte apoptosis-related gene 2 protein)

Cleaved into:

GeneID:132851

Gene names  (primary ):SPATA4

Gene names  (synonym ):TSARG2

Gene names  (ORF ):

Length:305

Mass:34751

Sequence:MAAAGQEKGYLTQTAAALDKSPSLSPQLAAPIRGRPKKCLVYPHAPKSSRLSRSVLRWLQGLDLSFFPRNINRDFSNGFLIAEIFCIYYPWELELSSFENGTSLKVKLDNWAQLEKFLARKKFKLPKELIHGTIHCKAGVPEILIEEVYTLLTHREIKSIQDDFVNFTDYSYQMRLPLVSRSTVSKSIKDNIRLSELLSNPNMLTNELKAEFLILLHMLQRKLGRKLNPEWFDVKPTVGEVTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGGSSHREIHVKQAGQHSYYSAMKPIRNMDKKP

Tissue specificity:Highly expressed in testis, the expression is observed precisely in seminiferous tubules. {ECO:0000269|PubMed:15158438}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp