MAFIP_HUMAN   Q8WZ33


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WZ33

Recommended name:MaFF-interacting protein

EC number:

Alternative names:(Tektin-4 like protein PP5644)

Cleaved into:

GeneID:

Gene names  (primary ):MAFIP

Gene names  (synonym ):MIP

Gene names  (ORF ):PP5644

Length:124

Mass:13947

Sequence:MLCPRAAFLVGSFHGVFPGPPASSHWEFWVPSTPVGAYFCPPQPQLTPPNTPKLVSEVEELYKSITALREKLLQAEQSLRNLKDIHMSLEKDVTAMTNSVFIDRQKCMAHRTCYPTILQLAGYQ

Tissue specificity:Strongly expressed in brain, kidney and ovary. Moderately expressed in liver, spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in heart, placenta, lung and leukocytes. {ECO:0000269|PubMed:15881666}.

Induction:

Developmental stage:

Protein families:Tektin family


   💬 WhatsApp