LCN1_HUMAN   P31025


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P31025

Recommended name:Lipocalin-1

EC number:

Alternative names:(Tear lipocalin) (Tlc) (Tear prealbumin) (TP) (von Ebner gland protein) (VEG protein)

Cleaved into:

GeneID:3933

Gene names  (primary ):LCN1

Gene names  (synonym ):VEGP

Gene names  (ORF ):

Length:176

Mass:19250

Sequence:MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD

Tissue specificity:Mainly expressed in lachrymal and salivary glands. Also expressed in the prostate.

Induction:

Developmental stage:

Protein families:Calycin superfamily, Lipocalin family


   💬 WhatsApp