DYT2B_HUMAN   Q8WW35


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WW35

Recommended name:Dynein light chain Tctex-type protein 2B

EC number:

Alternative names:(Tctex1 domain-containing protein 2)

Cleaved into:

GeneID:255758

Gene names  (primary ):DYNLT2B

Gene names  (synonym ):TCTEX1D2

Gene names  (ORF ):

Length:142

Mass:16122

Sequence:MATSIGVSFSVGDGVPEAEKNAGEPENTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNYTHDVFMNDSLFCVVAAFGCFYY

Tissue specificity:

Induction:

Developmental stage:

Protein families:Dynein light chain Tctex-type family


   💬 WhatsApp