CD3Z_HUMAN   P20963


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P20963

Recommended name:T-cell surface glycoprotein CD3 zeta chain

EC number:

Alternative names:(T-cell receptor T3 zeta chain) (CD antigen CD247)

Cleaved into:

GeneID:919

Gene names  (primary ):CD247

Gene names  (synonym ):CD3Z T3Z TCRZ

Gene names  (ORF ):

Length:164

Mass:18696

Sequence:MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Tissue specificity:CD3Z is expressed in normal lymphoid tissue and in peripheral blood mononuclear cells (PBMCs) (PubMed:11722641). {ECO:0000269|PubMed:11722641}.

Induction:

Developmental stage:

Protein families:CD3Z/FCER1G family


   💬 WhatsApp